PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa009106
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 285aa    MW: 33541.1 Da    PI: 4.528
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58687572PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-52803PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.8e-1959112356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k++++t +q++ Le+ Fe+++++  e++ +LAk+l+L+ rqV +WFqNrRa+ k
  Lsa009106  59 KKRRLTVDQVQFLERSFEEENKLEPERKIQLAKELNLQPRQVAIWFQNRRARCK 112
                56689***********************************************99 PP

2HD-ZIP_I/II125.13.2e-4058149192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrl+ +qv++LE+sFeee+kLeperK +la+eL+lqprqva+WFqnrRAR ktkqlEkdye L ++yd+lk+e + L+k++++L++e++
    Lsa009106  58 EKKRRLTVDQVQFLERSFEEENKLEPERKIQLAKELNLQPRQVAIWFQNRRARCKTKQLEKDYEILNSSYDKLKSEFDCLQKHNDTLKHEVE 149
                  69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.28E-1947116IPR009057Homeodomain-like
PROSITE profilePS5007117.50854114IPR001356Homeobox domain
SMARTSM003893.2E-1957118IPR001356Homeobox domain
CDDcd000861.58E-1659115No hitNo description
PfamPF000463.6E-1659112IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.3E-1961121IPR009057Homeodomain-like
PROSITE patternPS00027089112IPR017970Homeobox, conserved site
PfamPF021833.9E-16114156IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MEMEGGMMFE ALLKNQSLSF HSPWVPNSFH EEKSNKKKQP ENEENSDDDY EKCFRQPEKK  60
RRLTVDQVQF LERSFEEENK LEPERKIQLA KELNLQPRQV AIWFQNRRAR CKTKQLEKDY  120
EILNSSYDKL KSEFDCLQKH NDTLKHEVEM LKEKLQQTEK GEKDSIPNEI STKESDSNAQ  180
EPNPSPFSVK SWSQEPKLVI CKQEYANSVS TKSDIIDSYS DGNHSSFLEP CDSSNVFENQ  240
SDFSQDEEDN LTILRCPKIE YESYIDPNEG SLGYPIEDQP FWLWP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1106114RRARCKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015894877.13e-80PREDICTED: homeobox-leucine zipper protein HAT5
TrEMBLA0A103XSK11e-169A0A103XSK1_CYNCS; Homeobox, conserved site-containing protein
STRINGVIT_01s0026g01550.t011e-75(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-42homeobox 1